PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400037922
Common NameLOC102583094, StWRKY
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 173aa    MW: 19921.6 Da    PI: 9.5938
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400037922genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.41.5e-3393151159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d++vv++tYeg H h+
  PGSC0003DMP400037922  93 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLSKDEEVVVTTYEGMHSHP 151
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-3478151IPR003657WRKY domain
SuperFamilySSF1182907.06E-3085152IPR003657WRKY domain
PROSITE profilePS5081130.45888153IPR003657WRKY domain
SMARTSM007742.2E-3993152IPR003657WRKY domain
PfamPF031062.8E-2794151IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0010055Biological Processatrichoblast differentiation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0043620Biological Processregulation of DNA-templated transcription in response to stress
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MENYATIFPS ASSSSSHHDE YISLMNSKSS ISDDAKEELL FQGKNKAGFL GLMASMETPR  60
DIITKKDEVI KSCKKKIKKP RYAFQTRSQV DILDDGYRWR KYGQKAVKNN KFPRSYYRCT  120
HQGCNVKKQV QRLSKDEEVV VTTYEGMHSH PIDKSTDNFE HILSQMQIYT SF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-2983150774Probable WRKY transcription factor 4
2lex_A2e-2983150774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00506DAPTransfer from AT5G13080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0612450.0AB061245.1 Solanum tuberosum StWRKY mRNA for WRKY-type DNA binding protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001275604.11e-128probable WRKY transcription factor 75-like
SwissprotQ9FYA23e-60WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLQ8H9D71e-128Q8H9D7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000563521e-128(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22042461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.18e-61WRKY DNA-binding protein 75
Publications ? help Back to Top
  1. Dellagi A, et al.
    A potato gene encoding a WRKY-like transcription factor is induced in interactions with Erwinia carotovora subsp. atroseptica and Phytophthora infestans and is coregulated with class I endochitinase expression.
    Mol. Plant Microbe Interact., 2000. 13(10): p. 1092-101
    [PMID:11043470]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]